PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020467.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 352aa    MW: 38351.2 Da    PI: 6.6119
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020467.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.9e-102783132055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Do020467.1 278 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 313
                 4679*****************************885 PP

2ELK37.84e-13233254122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLl+KYsgyL+sL+qEFs
  Do020467.1 233 ELKYQLLKKYSGYLSSLRQEFS 254
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.8E-2288132IPR005540KNOX1
PfamPF037907.5E-2289130IPR005540KNOX1
SMARTSM012562.5E-30135186IPR005541KNOX2
PfamPF037912.3E-24140184IPR005541KNOX2
PROSITE profilePS5121311.627233253IPR005539ELK domain
PfamPF037894.2E-10233254IPR005539ELK domain
SMARTSM011881.2E-7233254IPR005539ELK domain
PROSITE profilePS5007112.892253316IPR001356Homeobox domain
SuperFamilySSF466891.07E-19254328IPR009057Homeodomain-like
SMARTSM003894.4E-13255320IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.7E-28258317IPR009057Homeodomain-like
CDDcd000866.85E-13265317No hitNo description
PfamPF059209.8E-17273312IPR008422Homeobox KN domain
PROSITE patternPS000270291314IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDQSFGNLGA GGSSSGGSNS AKAAAAVAVA SSSFLQLPLS TAAAAGTAPT GVAYYGAPLA  60
LLHQAAGPSS SQSPYGRHAS EISPAEAEAI KAKIVAHPQY SALLAAYLEC QKVGAPPDVL  120
ERLTAMAAKL DARPPGRHEH RDPELDQFME AYCNMLVKYR EELTRPIDEA MDFLKRVEAQ  180
LDSIAGATGG SSAARLSLAD GKSEGVGSSE DDMDPSGREN EPPEIDPRAE DKELKYQLLK  240
KYSGYLSSLR QEFSKKKKKG KLPKEARQKL LHWWELHYKW PYPSETEKIA LAESTGLDQK  300
QINNWFINQR KRHWKPSEDM PFVMMEGFHP QSAAALYMDG PFMADGMYRL GS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0333610.0BT033361.1 Zea mays full-length cDNA clone ZM_BFb0146E21 mRNA, complete cds.
GenBankKJ7275690.0KJ727569.1 Zea mays clone pUT5429 HB transcription factor (HB132) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955415.10.0PREDICTED: homeobox protein rough sheath 1-like
SwissprotO650341e-177KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804161e-177KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLA0A0A9N8T50.0A0A0A9N8T5_ARUDO; Rs1
STRINGMLOC_11678.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-97KNOTTED-like from Arabidopsis thaliana